PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016460564.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 812aa    MW: 89663.5 Da    PI: 6.7929
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016460564.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding262.1e-0885127347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT +E+e +  a +q G++ +++I ++++  +   q++++++ +
   XP_016460564.1  85 AWTSQEEESFFSALRQVGKN-FEKITSRVQ-SKNKDQVRHYYYRL 127
                      6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.49E-1080132IPR009057Homeodomain-like
PROSITE profilePS5129313.31781132IPR017884SANT domain
SMARTSM007175.3E-682130IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-584130IPR009057Homeodomain-like
PfamPF002492.7E-685127IPR001005SANT/Myb domain
CDDcd001671.68E-585128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 812 aa     Download sequence    Send to blast
MQMEPQVALE CDRCLHPETL MCKDGVSDVT QHPAAAQPVI PSEDHPVSQL SVPTHDHAVT  60
QQVSSSQDRV TLQKPAKRQT RQWAAWTSQE EESFFSALRQ VGKNFEKITS RVQSKNKDQV  120
RHYYYRLVRR MNKLLGPELC LDAKNSKDTN AAMLRWWSLL EKSSCKASKL HLKPRRFKIF  180
IETLESQLLK DRKKNVRRRP SQGESSSTAA ASLSSHSRVS TNDSRTVKVV LLDDQGIQKF  240
GSGKGSSLKR HVTMGVNRSN AKVDSSPVKN ARHRRKIGSV SAAAYKRWEK AAIAGVSLVA  300
DAAEHLERAT IGINGFEHVG KDVHSLLTLS QNLLNETNLQ SCMKLKLQLF PVDEGTRRAL  360
EMDNHNPYLE LTLSNRKKMS SVLEHLNRKW GSSSIATGEL VLFPYHVQME NLVQSLRWTK  420
DTTLSAADVN NLIGSPPVFR LRYGWFPNSE LGTFQAPLSS TTPFTQNTNT NITEEMNAEI  480
LASSHGKLVR FSKEPLVSNP RMTVTSSSTE LSGESNLQAS MGLNTYNSDH NETLPSHRRE  540
KGAITTEKQV EMHDMQGSKT SALSAGDWED SLTNISVGDL LSDAPDDEET DCIESTLPGS  600
SHFLQQMPFS CDSFDAAIAA HIYKHQSKAE SQMALPPQAS SIWNAEDTCD AFAFQKDVAS  660
RLKAHNSSSN VGAENCQHIS QSSSLLLDAG IKDLPGKMEP ITDEPAHEDP VDECQSNAQA  720
LGGSTKDLSL LSDIYWPDSL GPLELDAPSC RYHSEDLILS DNSLGGLNRL IASSLDAFQN  780
CSFFGLDKKE PGSTVEAVET TSLADYKIGA KV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6476041e-136EF647604.1 Solanum lycopersicum chromosome 9 clone C09HBa0116C14, complete sequence.
GenBankHG9755211e-136HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016460564.10.0PREDICTED: TSL-kinase interacting protein 1-like isoform X3
SwissprotQ8LJT80.0TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLK4CQJ90.0K4CQJ9_SOLLC; Uncharacterized protein
STRINGSolyc09g008100.2.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.20.0TSL-kinase interacting protein 1